PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00010992-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NAC
Protein Properties Length: 378aa    MW: 43730.8 Da    PI: 6.2436
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00010992-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.24.8e-51151381128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd++   ++ +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk 
  WALNUT_00010992-RA  15 VPPGFRFHPTEEELLQYYLRKKVSYEKIDL-DVIRDVDLNKSEPWDIRG--TTPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKV 102
                         69****************************.9***************83..34679**********************************9 PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + s +g+ +g++ktLvfy+grap+g k+dW+mheyrl
  WALNUT_00010992-RA 103 ISS-NGRRIGMRKTLVFYRGRAPHGLKSDWIMHEYRL 138
                         999.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-589168IPR003441NAC domain
PROSITE profilePS5100556.48815168IPR003441NAC domain
PfamPF023652.1E-2716138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MPENMSISVN GQSQVPPGFR FHPTEEELLQ YYLRKKVSYE KIDLDVIRDV DLNKSEPWDI  60
RGTTPQNDWY FFSHKDKKYP TGTRTNRATA AGFWKATGRD KVISSNGRRI GMRKTLVFYR  120
GRAPHGLKSD WIMHEYRLDD NITDTNISNT MGEAIQEEGW VVCRIFRKKS HQKTLDSPII  180
SSIIAETRTQ QVFDSCDEGA LEQILQYTEN SSKELEKDSK SGTIFRPIDN AGMKHCYQYE  240
RFMKLPSLES PNSSCGKKHY QLINSPEMIA ENDQGLVIKQ VSETDPNSDY KMDSAAAITN  300
WAALDRLVAS QLNDQLPEDF KQLVSFDDPN MGYCTQDHHH DDHLEFPTLR SSSSSINRFY  360
HIPRQDYNSE IDLWNFRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4891709170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051441.11e-173Transcription factor
SwissprotQ84WP61e-125NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A061E0071e-173A0A061E007_THECC; Transcription factor
STRINGGLYMA16G02200.21e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-116NAC family protein